PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Glyma.14G001600.1.p
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Phaseoleae; Glycine; Soja
Family Nin-like
Protein Properties Length: 584aa    MW: 64871.4 Da    PI: 6.7301
Description Nin-like family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Glyma.14G001600.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1RWP-RK90.99.5e-29360411152
               RWP-RK   1 aekeisledlskyFslpikdAAkeLgvclTvLKriCRqyGIkRWPhRkiksl 52 
                          aek+isl +l++yF++++kdAAk++gvc+T+LKriCRq+GI RWP+Rkik++
  Glyma.14G001600.1.p 360 AEKTISLPVLRQYFAGSLKDAAKSIGVCPTTLKRICRQHGITRWPSRKIKKV 411
                          589***********************************************97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5151917.291350431IPR003035RWP-RK domain
PfamPF020422.5E-24364411IPR003035RWP-RK domain
SuperFamilySSF542773.6E-22469560No hitNo description
Gene3DG3DSA:3.10.20.2409.5E-22472555No hitNo description
SMARTSM006661.0E-23473558IPR000270PB1 domain
PROSITE profilePS5174521.936473558IPR000270PB1 domain
CDDcd064072.20E-39474557No hitNo description
PfamPF005644.8E-14474557IPR000270PB1 domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0005515Molecular Functionprotein binding
Sequence ? help Back to Top
Protein Sequence    Length: 584 aa     Download sequence    Send to blast
MEYGGFGSLS ECEEELIEEL LVQGCWVETS GRSEEMPMGK TWWIGPKANH ASVKERLEAA  60
MGYLREYTNN NIQIWVPLRR SAGQELGTDE SDTIAFERNR NVKLRLFRSQ EGCVGVPVLE  120
RGSGTCLGVL EIVMEDEVVS EMMEVVRCVC KAQKVPLALA WAPCVQQKQA KTSSGRSLAT  180
AKPCFATDIT AFSNAEYPLS HHASIFDLHA AVAIPLTTFS SSFHFVLEFF LPLDCPDHNH  240
FLNSLSLLLH QACRSTFHLS LIHDHHLDFE FLPTESPSQA SWIAHMMEAQ SQHIKGVCLS  300
LEEEPKEEFK VTTTHYCNWD STATSTYQAH DQVVFGEESH THTFGGKRGR KPGEKRRTKA  360
EKTISLPVLR QYFAGSLKDA AKSIGVCPTT LKRICRQHGI TRWPSRKIKK VGHSLKKLQL  420
VIDSVQGAEG AIQIGSFYNS FPELSSQSSK SNNNNNSSSP TAAAAAAQSP QQPLRVKATF  480
ADEKIRFSLQ PHWGFTELQL EIARRFNLND VSNGYLVLKY LDDDGEWVVL ACDGDLEECK  540
DLHTTSQSRT IRLALFQASP LNNLPNTYTF AAATPSSSLA VSL*
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAJ2390416e-95AJ239041.1 Lotus corniculatus var. japonicus mRNA for nodule inception protein (nin).
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_006596576.10.0PREDICTED: protein NLP2
SwissprotQ7X9B92e-94NLP2_ARATH; Protein NLP2
TrEMBLI1M6400.0I1M640_SOYBN; Uncharacterized protein
STRINGGLYMA14G00470.10.0(Glycine max)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF12373399
Representative plantOGRP2991697
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G17150.12e-68Nin-like family protein